Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

286 – 300 of 1,553,790 results

286

Invitrogen™ RAB5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	M0RC99, P20339
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	RAB5
Gene Symbols	RAB5A
Regulatory Status	RUO
Gene Alias	2410015H04Rik; AI663973; AU021172; nnyRab5a; Rab 5; Rab 5A; RAB5; RAB5A; RAB5A, member RAS oncogene family; Ras related protein; RAS-associated protein RAB5A; ras-related protein Rab-5A; Small GTP-binding protein rab5
Gene	RAB5A
Product Type	Antibody
Gene ID (Entrez)	5868, 64633
Formulation	Whole Serum with 0.05% sodium azide
Immunogen	Recombinant human Rab5.
Classification	Polyclonal
Primary or Secondary	Primary

287

Invitrogen™ p16INK4a Recombinant Rabbit Monoclonal Antibody (RM267)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P42771
Isotype	IgG
Concentration	1 mg/mL
Antigen	p16INK4a
Gene Symbols	CDKN2A
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Alternative reading frame; Arf; ARF-INK4a; CDK4 inhibitor p16 INK4; CDK4 inhibitor p16-INK4; CDK4I; CDKN2; Cdkn2a; cdkn2a {ECO:0000312; cell cycle inhibitor; cell cycle negative regulator beta; cell cycle regulator; CMM2; Cyclin dependent kinase 4 inhibitor A; cyclin dependent kinase inhibitor 2A; Cyclin dependent kinase inhibitor 2A (p16, inhibits CDK4); cyclin-dependent kinase 4 inhibitor A; Cyclin-dependent kinase inhibitor 2A; cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4); cyclin-dependent kinase inhibitor 2A (p16, inhibits CDK4); cyclin-dependent kinase inhibitor 2a p16Ink4a; cyclin-dependent kinase inhibitor 2a p19Arf; cyclin-dependent kinase inhibitor 2A, isoform 1; cyclin-dependent kinase inhibitor 2A, isoform 2; cyclin-dependent kinase inhibitor 2A, isoform 3; cyclin-dependent kinase inhibitor 2A, isoforms 1/2; cyclin-dependent kinase inhibitor protein; EMBL:AAL76336.1, ECO:0000312; EMBL:AAL76338.1, ECO:0000312; HGNC:1787; inhibits CDK4; INK4; INK4A; Ink4a/Arf; INK4a-ARF; isoforms 1/2/3; Melanoma p16 inhibits CDK4; mitochondrial smARF; MLM; MTS1; MTS-1; Multiple tumor suppressor 1; P14; P14 P16; P14ARF; p16; p16(INK4a); p16Cdkn2a; P16INK4; p16-INK4; p16INK4a; p16-INK4a; P19; P19 TP16; p19>ARF>; P19ARF; Pctr1; RGD:2323}; TP16; Tumor suppressor ARF
Gene	CDKN2A
Product Type	Antibody
Gene ID (Entrez)	1029
Formulation	PBS with 1% BSA, 50% glycerol and 0.09% sodium azide
Immunogen	A peptide corresponding to the C-terminus of human p16INK4a (Cyclin-dependent kinase inhibitor 2A).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	RM267

288

Invitrogen™ CD9 Monoclonal Antibody (MEM-61), FITC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P21926
Isotype	IgG1 κ
Concentration	55 μg/mL
Antigen	CD9
Gene Symbols	CD9
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	5H9; 5H9 antigen; antigen CD9; BA2; BA-2/p24 antigen; BTCC-1; CD9; CD9 antigen; CD9 antigen (p24); CD9 molecule; cell growth-inhibiting gene 2 protein; DRAP-27; GIG2; Leukocyte antigen MIC3; MIC3; motility related protein-1; Motility-related protein; MRP-1; p24; sCD 9; sCD9; soluble CD 9; soluble CD9; Tetraspanin29; Tetraspanin-29; transmembrane protein CD9; TSPAN29; Tspan-29
Gene	CD9
Product Type	Antibody
Gene ID (Entrez)	928
Formulation	PBS with 0.2% BSA and 15mM sodium azide; pH 7.4
Immunogen	Pre-B cell line NALM-6.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MEM-61

289

Invitrogen™ mtHSP70 Monoclonal Antibody (JG1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Canine,Human,Mouse,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P0DMV8, Q61696
Isotype	IgG3
Concentration	1.07 mg/mL
Antigen	mtHSP70
Gene Symbols	HSPA1A
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	68 kDa heat shock protein; dnaK-type molecular chaperone HSP70-1; epididymis secretory protein Li 103; heat shock 70 kDa protein 1; heat shock 70 kDa protein 1/2; heat shock 70 kDa protein 1A; heat shock 70 kDa protein 1A/1B; Heat shock 70 kDa protein 1B; Heat shock 70 kDa protein 2; Heat shock 70 kDa protein 3; heat shock 70kD protein 1A; heat shock 70kDa protein 1A; heat shock protein 1A; heat shock protein family A (Hsp70) member 1A; heat shock protein, 70 kDa 3; heat shock-induced protein; HEL-S-103; Hsp68; HSP70.1; HSP70.1/HSP70.2; Hsp70.3; HSP70-1; HSP70-1/HSP70-2; HSP70-1A; HSP70-2; Hsp70-3; Hsp70A1; HSP70I; Hsp72; HSPA1; Hspa1a; HSPA1B; HSX70; inducible heat shock protein 70
Gene	HSPA1A
Product Type	Antibody
Gene ID (Entrez)	193740, 3303
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues G(615) S G S S G T G E Q K E D Q K E E K Q(633) of mouse mtHSP70.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	JG1

290

Invitrogen™ NEFM Monoclonal Antibody (3H11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunohistochemistry (PFA fixed),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P07197, P12839
Concentration	1 mg/mL
Antigen	NEFM
Gene Symbols	NEFM
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	160 kDa neurofilament protein; major neuronal intermediate filament subunit; medium neurofilament subunit; middle molecular weight neurofilament protein NF-M(2); Nef3; Nefm; nef-m; nefm.S; nefm-a; nefm-b; Neurofilament 3; neurofilament 3 (150kDa medium); neurofilament 3, medium; neurofilament M subunit; neurofilament medium; neurofilament medium polypeptide; neurofilament medium S homeolog; neurofilament medium tail domain; neurofilament protein M; Neurofilament protein, middle polypeptide; neurofilament triplet M protein; neurofilament, medium polypeptide; neurofilament, medium polypeptide 150kDa; neurofilament, medium polypeptide S homeolog; neurofilament-3 (150 kD medium); neurofilament-M; neurofilament-M subunit; neuronal intermediate filament; NF160; NF165; NFM; NF-M; NF-M c-terminus; NF-M protein; NMC; XELAEV_18020229mg
Gene	NEFM
Product Type	Antibody
Gene ID (Entrez)	24588, 4741
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to a C-terminal fragment of rat neurofilament.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	3H11

291

Invitrogen™ IL-12 p70 Monoclonal Antibody (C17-8), Biotin

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse
Host Species	Rat
Conjugate	Biotin
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	P43431, P43432
Isotype	IgG2a
Concentration	0.5 mg/mL
Antigen	IL-12 p70
Gene Symbols	IL12A, Il12b
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	20C2; CLMF; CLMF p35; CLMF p40; CLMF2; cytokine; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; Cytotoxic lymphocyte maturation factor 40 kDa subunit; il 12; IL 12p70; Il12; IL-12; Il-12 p35; IL-12 p75; IL-12 subunit p35; IL-12 subunit p40; IL-12, subunit p35; IL12, subunit p40; Il-12; cytokine; IL12A; IL-12A; IL12A/B; IL12AB; IL12B; Il-12b; IL12P35; IL-12p35; Il12p40; Il-12p40; IL35 subunit; ILN; IMD28; IMD29; Interleukin; interleukin 12 35 kDa subunit; interleukin 12 35kDa subunit; interleukin 12 40 kDa subunit; interleukin 12 40kDa subunit; interleukin 12 p35 subunit; interleukin 12 p40 subunit precursor; interleukin 12 polypeptide 35; interleukin 12, p35; interleukin 12, p40; interleukin 12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); interleukin 12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); interleukin 12p35 subunit precursor; interleukin-12 alpha chain; interleukin-12 alpha p40 subunit; interleukin-12 beta chain; interleukin-12 beta p35 subunit; interleukin-12 p35 subunit; interleukin-12 p35 subunit precursor; interleukin-12 p40; interleukin-12 p40 subunit; interleukin-12 p40 subunit precursor; Interleukin-12 p70; interleukin-12 subunit alpha; Interleukin-12 subunit beta; interleukin-23 p40 subunit; Ll12a; MGC151228; MGC151232; natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35; natural killer cell stimulatory factor, 40 kD subunit; NF cell stimulatory factor chain 1; NFSK; NK cell stimulatory factor chain 1; NK cell stimulatory factor chain 2; NKSF; NKSF1; NKSF2; P35; p40
Gene	IL12A
Product Type	Antibody
Gene ID (Entrez)	16159, 16160
Formulation	PBS with 4% BSA and proprietary Preservative
Immunogen	Recombinant mouse IL-12.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C17-8

292

Invitrogen™ eIF4A3 Recombinant Rabbit Monoclonal Antibody (17H5L19)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P38919, Q91VC3
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	eIF4A3
Gene Symbols	EIF4A3
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2400003O03Rik; ATP-dependent RNA helicase DDX48; ATP-dependent RNA helicase eIF4A-3; Ddx48; DEAD (Asp-Glu-Ala-Asp) box polypeptide 48; DEAD box protein 48; Eif4a3; eIF4AIII; eIF-4A-III; eIF4A-III; eukaryotic initiation factor 4AIII; Eukaryotic initiation factor 4A-III; Eukaryotic initiation factor 4A-III, N-terminally processed; Eukaryotic initiation factor 4A-III-like protein; eukaryotic initiation factor 4A-like NUK-34; eukaryotic translation initiation factor 4A; Eukaryotic translation initiation factor 4A isoform 3; eukaryotic translation initiation factor 4A, isoform 3; eukaryotic translation initiation factor 4A3; hNMP 265; KIAA0111; mKIAA0111; MUK34; NMP 265; NMP265; Nuclear matrix protein 265; NUK34; RCPS; similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 48; zgc:56139
Gene	EIF4A3
Product Type	Antibody
Gene ID (Entrez)	192170, 9775
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	Peptides corresponding to human eIF4A3 (aa 15-33, 302-318).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	17H5L19

293

Invitrogen™ MMP13 Monoclonal Antibody (VIIIA2)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	P33435, P45452
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	MMP13
Gene Symbols	MMP13
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	cb1034; Clg; CLG3; Collagenase; collagenase 3; collagenase 3a; matrix metalloproteinase 13a; collagenase-1; Collagenase3; Collagenase-3; collagenase-3 precursor; interstitial collagenase; MANDP1; matrix metallo protease; matrix metallopeptidase 13; matrix metallopeptidase 13 (collagenase 3); matrix metallopeptidase 13a; matrix metallopeptidase 13a (collagenase 3); matrix metalloproteinase 13; matrix metalloproteinase 13 (collagenase 3); matrix metalloproteinase-13; matrix metalloproteinase-13; MMP-13; interstitial protein; MMP; Mmp1; MMP13; MMP-13; mmp13 protein; mmp13a; MMPLg; MMPLh; MMPs; Procollagenase 3; UMRCASE; ZFMMP13
Gene	MMP13
Product Type	Antibody
Gene ID (Entrez)	17386, 4322
Formulation	PBS with 0.2% BSA and 0.09% sodium azide; pH 7.4
Immunogen	Human recombinant collagenase-3 protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	VIIIA2

294

Invitrogen™ PAI1 Monoclonal Antibody (MA-33H1F7)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Functional Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P05121, P20961, P22777
Isotype	IgG1
Concentration	0.1 mg/mL
Antigen	PAI1
Gene Symbols	Serpine1
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	Endothelial plasminogen activator inhibitor; nexin, plasminogen activator inhibitor type 1; PAI; PAI1; PAI-1; PAI1 protein; PAI1A; Pai1aa; Planh; Planh1; plas; plasminogen activator inhibitor; plasminogen activator inhibitor 1; plasminogen activator inhibitor I; plasminogen activator inhibitor, type I; plasminogen activator inhibitor-1; Plasminogen activator inhibitor-1 precursor (PAI-1) (Endothelial plasminogen activator inhibitor) (PAI); putative plasminogen activator inhibitor-1; RATPAI1A; serine (or cysteine) peptidase inhibitor, clade E, member 1; serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1; serine (or cysteine) proteinase inhibitor, clade E, member 1; serine (or cysteine) proteinase inhibitor, member 1; serpin E1; serpin family E member 1; serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1; SERPINE1; SERPINE-1
Gene	Serpine1
Product Type	Antibody
Gene ID (Entrez)	18787, 24617, 5054
Formulation	PBS with 0.1% BSA and no preservative
Immunogen	Human PAI-1.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MA-33H1F7

295

Invitrogen™ Rotavirus A VP6 Monoclonal Antibody (UK1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Virus
Host Species	Mouse
Conjugate	Unconjugated
Applications	Lateral Flow
Form	Liquid
Isotype	IgG1
Concentration	6.99 mg/mL
Antigen	Rotavirus A VP6
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Reoviridae
Product Type	Antibody
Formulation	PBS with 15mM sodium azide; pH 7.5
Immunogen	Human Rotavirus, purified by Caesium Chloride gradient.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	UK1

296

Invitrogen™ GATA6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q61169, Q92908
Isotype	IgG
Concentration	1 mg/mL
Antigen	GATA6
Gene Symbols	GATA6
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA410133; ASD9; AVSD5; DNA-binding protein GATA-GT2; GATA binding protein 6; Gata6; GATA-6; GATA-binding factor 6; GATA-binding protein 6; LOW QUALITY PROTEIN: transcription factor GATA-6; transcription factor GATA6; transcription factor GATA-6; zinc-finger transcription factor
Gene	GATA6
Product Type	Antibody
Gene ID (Entrez)	14465, 2627
Formulation	PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide
Immunogen	Synthetic peptide sequence KYSGQDGLYIGVSLASPAE & KRFGAAGADASDSRAFPARE.
Classification	Polyclonal
Primary or Secondary	Primary

297

Invitrogen™ Caspase 8 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	O89110, Q14790, Q9JHX4
Isotype	IgG
Concentration	1 mg/mL
Antigen	Caspase 8
Gene Symbols	Casp8
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	ALPS2B; apoptosis-related cysteine peptidase; apoptotic cysteine protease; Apoptotic protease Mch-5; CAP4; CASP8; CASP-8; caspase 8; caspase 8, apoptosis-related cysteine peptidase; caspase 8, apoptosis-related cysteine protease; Caspase8; caspase-8; Caspase-8 precursor; Caspase-8 subunit p10; Caspase-8 subunit p18; EC 3.4.22.61; FADD-homologous ICE/ced-3-like protease; FADD-like ICE; Fas-linked ICE-like protease; FLICE; FLJ17672; ICE8; ICE-like apoptotic protease 5; MACH; MACH-alpha-1/2/3 protein; MACH-beta-1/2/3/4 protein; MCH5; MGC78473; MORT1-associated ced-3 homolog; OTTHUMP00000163720; OTTHUMP00000165063; OTTHUMP00000206557; OTTHUMP00000206581
Gene	Casp8
Product Type	Antibody
Gene ID (Entrez)	12370, 64044, 841
Formulation	PBS with 0.02% sodium azide
Immunogen	A peptide corresponding to 16 amino acid synthetic peptide near the carboxyl terminus of human Caspase-8.
Classification	Polyclonal
Primary or Secondary	Primary

298

Invitrogen™ BMP5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P22003, P49003
Isotype	IgG
Concentration	500 μg/mL
Antigen	BMP5
Gene Symbols	Bmp5
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AU023399; BMP; BMP 5; Bmp5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; bone morphogenetic protein 5; MGC34244; se; short ear
Gene	Bmp5
Product Type	Antibody
Gene ID (Entrez)	12160, 315824, 653
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).
Classification	Polyclonal
Primary or Secondary	Primary

299

Invitrogen™ RANBP2 Monoclonal Antibody (2E1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P49792
Isotype	IgG2b
Concentration	1 mg/mL
Antigen	RANBP2
Gene Symbols	RANBP2
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	358 kDa nucleoporin; A430087B05Rik; acute necrotizing encephalopathy 1 (autosomal dominant); ADANE; AI256741; ANE1; E3 SUMO-protein ligase RanBP2; E3 SUMO-protein transferase RanBP2; IIAE3; Nuclear pore complex protein Nup358; nucleoporin 358; nucleoporin Nup358; NUP358; P270; RAN binding protein 2; ran-binding protein 2; RANBP2; RBP2; retina-specific cyclophilin; RGD1560047; spliced variant with Ran-binding and cyclophilin domains; transformation-related protein 2; TRP1; TRP2
Gene	RANBP2
Product Type	Antibody
Gene ID (Entrez)	5903
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Recombinant protein corresponding to 150 N-terminal residues of human Nup358.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2E1

300

Invitrogen™ Reelin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P58751, Q60841
Isotype	IgG
Concentration	0.69 mg/mL
Antigen	Reelin
Gene Symbols	RELN
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	ETL7; extracellular matrix serine protease; LIS2; PRO1598; Reelen; reeler; Reeler protein; Reelin; RELN; Rl
Gene	RELN
Product Type	Antibody
Gene ID (Entrez)	19699, 24718
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the C-terminus region of mouse Reelin. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
18
19
20
21
...
103,586
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ RAB5 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ p16INK4a Recombinant Rabbit Monoclonal Antibody (RM267) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD9 Monoclonal Antibody (MEM-61), FITC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ mtHSP70 Monoclonal Antibody (JG1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NEFM Monoclonal Antibody (3H11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-12 p70 Monoclonal Antibody (C17-8), Biotin Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MMP13 Monoclonal Antibody (VIIIA2) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PAI1 Monoclonal Antibody (MA-33H1F7) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Rotavirus A VP6 Monoclonal Antibody (UK1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GATA6 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Caspase 8 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BMP5 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RANBP2 Monoclonal Antibody (2E1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Reelin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RAB5 Polyclonal Antibody

Invitrogen™ p16INK4a Recombinant Rabbit Monoclonal Antibody (RM267)

Invitrogen™ CD9 Monoclonal Antibody (MEM-61), FITC

Invitrogen™ mtHSP70 Monoclonal Antibody (JG1)

Invitrogen™ NEFM Monoclonal Antibody (3H11)

Invitrogen™ IL-12 p70 Monoclonal Antibody (C17-8), Biotin

Invitrogen™ MMP13 Monoclonal Antibody (VIIIA2)

Invitrogen™ PAI1 Monoclonal Antibody (MA-33H1F7)

Invitrogen™ Rotavirus A VP6 Monoclonal Antibody (UK1)

Invitrogen™ GATA6 Polyclonal Antibody

Invitrogen™ Caspase 8 Polyclonal Antibody

Invitrogen™ BMP5 Polyclonal Antibody

Invitrogen™ RANBP2 Monoclonal Antibody (2E1)

Invitrogen™ Reelin Polyclonal Antibody